Pab Rb x human AP2M1, CT (AP-2 Complex Subunit Mu) antibody 370912 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human AP2M1, CT (AP-2 Complex Subunit Mu) antibody

Western blot analysis of AP2M1 expression in rat kidney extract (lane 1), NIH3T3 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). AP2M1 at 50KD was detected using AP2M1 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human AP2M1, CT (AP-2 Complex Subunit Mu) antibody

The Pab Rb x human AP2M1, CT (AP-2 Complex Subunit Mu) antibody from United States Biological is a Rabbit Polyclonal antibody to Ap2m1. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human AP2M1, CT (AP-2 Complex Subunit Mu) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human AP2M1, CT (AP-2 Complex Subunit Mu) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370912
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the C-terminal of human AP2M1 (aa399-435, LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameadaptor related protein complex 2 subunit mu 1
NCBI Gene AliasesAP50, MRD60, CLAPM1, mu2
ClonalityPolyclonal
TargetAP2M1, CT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!