Pab Rb x human LIMK1, CT (LIM domain kinase 1) antibody 350717 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human LIMK1, CT (LIM domain kinase 1) antibody

All lanes: LIMK1at 0.5ug/ml Lane 1: Rat Brain Tissue Lysate at 50ug Lane 2: Mouse Gaster Tissue Lysate at 50ug Lane 3: HELA Whole Cell Lysate at 40ug Lane 4: U87 Whole Cell Lysate at 40ug Lane 5: SKOV Whole Cell Lysate at 40ug Predicted bind size: 72kD Observed bind size: 72kD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human LIMK1, CT (LIM domain kinase 1) antibody

The Pab Rb x human LIMK1, CT (LIM domain kinase 1) antibody from United States Biological is a Rabbit Polyclonal antibody to LIM domain kinase 1, and LIMK1. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human LIMK1, CT (LIM domain kinase 1) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human LIMK1, CT (LIM domain kinase 1) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number350717
ClonalityPolyclonal
TargetLIMK1, CT
NCBI Gene AliasesLIMK, LIMK-1
NCBI Full Gene NameLIM domain kinase 1
ApplicationsWestern Blot (WB)
ReactivityHu, Ms, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to aa599-634, KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWET- YRR, of human LIMK1 at C-terminal
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!