Pab Rb x human NECTIN4, NT (PVRL4, Nectin-4) antibody 371013 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human NECTIN4, NT (PVRL4, Nectin-4) antibody

Western blot analysis of Nectin-4/PVRL4 expression in MCF-7 whole cell lysates (lane 1) and MM453 whole cell lysates (lane 2). Nectin-4/PVRL4 at 66KD was detected using Nectin-4/PVRL4 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human NECTIN4, NT (PVRL4, Nectin-4) antibody

United States Biological's Pab Rb x human NECTIN4, NT (PVRL4, Nectin-4) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human NECTIN4, NT (PVRL4, Nectin-4) antibody was generated using NECTIN4 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemPab Rb x human NECTIN4, NT (PVRL4, Nectin-4) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371013
ClonalityPolyclonal
TargetNECTIN4, NT
NCBI Gene AliasesLNIR, nectin-4, EDSS1, PRR4, PVRL4
NCBI Full Gene Namenectin cell adhesion molecule 4
ApplicationsWestern Blot (WB)
ReactivityHuman (Hu)
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human Nectin-4 (aa53-94, FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by 7aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!