Pab Rb x human MC2 Receptor (Adrenocorticotropic Hormone Receptor) antibody 377496 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human MC2 Receptor (Adrenocorticotropic Hormone Receptor) antibody

Western blot analysis of MC2 receptor expression in mouse brain extract (lane 1). MC2 receptor at 39kD was detected using MC2 receptor at 0.5ug/ml. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human MC2 Receptor (Adrenocorticotropic Hormone Receptor) antibody

The Pab Rb x human MC2 Receptor (Adrenocorticotropic Hormone Receptor) antibody from United States Biological is a Rabbit Polyclonal antibody to MC2R. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The Pab Rb x human MC2 Receptor (Adrenocorticotropic Hormone Receptor) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human MC2 Receptor (Adrenocorticotropic Hormone Receptor) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number377496
ClonalityPolyclonal
TargetMC2 Receptor
NCBI Gene AliasesACTHR
NCBI Full Gene Namemelanocortin 2 receptor
ApplicationsWestern Blot (WB)
ReactivityHu, Ms
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to aa268-297, NAVIDPFIYAFRSPELRDAFKKMIFCSRYW from human MC2 receptor at C-terminal, different from the related mouse sequence by 4aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!