Pab Rb x human CCDC6, NT (Coiled-coil Domain-containing Protein 6) antibody 370931 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human CCDC6, NT (Coiled-coil Domain-containing Protein 6) antibody

Western blot analysis of CCDC6 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). CCDC6 at 66KD was detected using CCDC6 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human CCDC6, NT (Coiled-coil Domain-containing Protein 6) antibody

The Pab Rb x human CCDC6, NT (Coiled-coil Domain-containing Protein 6) antibody from United States Biological is a Rabbit Polyclonal antibody to CCDC6. This antibody recognizes Homo Sapiens, Human, and Rat antigen. The Pab Rb x human CCDC6, NT (Coiled-coil Domain-containing Protein 6) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human CCDC6, NT (Coiled-coil Domain-containing Protein 6) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370931
Antibody TypePrimary
ReactivityHu, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human CCDC6 (aa156-198, KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence. Species Sequence Homology: bovine, chicken, equine, hamster, canine, monkey, rabbit, zebrafish
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namecoiled-coil domain containing 6
NCBI Gene AliasesTPC, PTC, D10S170, H4, PTC1, TST1
ClonalityPolyclonal
TargetCCDC6, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!