Pab Rb x human EPHX2, CT (Bifunctional Epoxide Hydrolase 2) antibody 370961 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human EPHX2, CT (Bifunctional Epoxide Hydrolase 2) antibody

Western blot analysis of EPHX2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and HEPG2 whole cell lysates (lane 3). EPHX2 at 62KD was detected using EPHX2 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human EPHX2, CT (Bifunctional Epoxide Hydrolase 2) antibody

United States Biological's Pab Rb x human EPHX2, CT (Bifunctional Epoxide Hydrolase 2) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human EPHX2, CT (Bifunctional Epoxide Hydrolase 2) antibody was generated using EPHX2 as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemPab Rb x human EPHX2, CT (Bifunctional Epoxide Hydrolase 2) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370961
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the C-terminal of human EPHX2 (aa505-543, QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by 7aa, and from the related rat sequence by 8aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameepoxide hydrolase 2
NCBI Gene AliasesABHD20, SEH, CEH
ClonalityPolyclonal
TargetEPHX2, CT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!