Pab Rb x mouse PML, NT (Protein PML) antibody 371025 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x mouse PML, NT (Protein PML) antibody

Western blot analysis of PML Protein expression in mouse testis extract (lane 1). PML Protein at 72KD, 97KD was detected using PML Protein at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Pab Rb x mouse PML, NT (Protein PML) antibody

PML Protein was detected in paraffin-embedded sections of mouse spleen tissues using PML Protein at 1ug/mL. The immunohistochemical section was developed using SABC method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x mouse PML, NT (Protein PML) antibody

The Pab Rb x mouse PML, NT (Protein PML) antibody from United States Biological is a Rabbit Polyclonal antibody to PML. This antibody recognizes Mouse antigen. The Pab Rb x mouse PML, NT (Protein PML) antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemPab Rb x mouse PML, NT (Protein PML) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371025
Antibody TypePrimary
ReactivityMo
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of mouse PML Protein (aa140-177, LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by 6aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namepromyelocytic leukemia
NCBI Gene AliasesTrim19, 1200009E24Rik
ClonalityPolyclonal
TargetPML, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!