Rabbit Anti-SMAD1/2/3/4/5 Antibody 303618 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-SMAD1/2/3/4/5 Antibody

Anti-SMAD antibody, Western blotting All lanes: Anti SMAD at 0.5ug/ml Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug Lane 2: Mouse Cardiac Muscle Tissue Lysate at 50ug Lane 3: Rat Skeletal Muscle Tissue Lysate at 50ug Lane 4: Mouse Skeletal Muscle Tissue Lysate at 50ug Lane 5: 293T Whole Cell Lysate at 40ug Lane 6: MCF-7 Whole Cell Lysate at 40ug Lane 7: HELA Whole Cell Lysate at 40ug Predicted band size: 52KD Observed band size: 52KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-SMAD1/2/3/4/5 Antibody

United States Biological's Rabbit Anti-SMAD1/2/3/4/5 Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-SMAD1/2/3/4/5 Antibody was generated using SMAD1 as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemRabbit Anti-SMAD1/2/3/4/5 Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303618
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa240-270, QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH, from the middle region of human SMAD1/2/3/4/5, different from the related mouse sequence by 2aa, and from the related rat sequence by 5aa
TargetSMAD1/2/3/4/5
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameSMAD family member 1
NCBI Gene AliasesBSP-1, BSP1, JV4-1, JV41, MADH1, MADR1
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!