Rabbit Anti-PIM1, CT Antibody 303531 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-PIM1, CT Antibody

Anti-PIM1 antibody, Western blotting All lanes: Anti PIM1 at 0.5ug/ml Lane 1: U20S Whole Cell Lysate at 40ug Lane 2: A549 Whole Cell Lysate at 40ug Lane 3: COLO320 Whole Cell Lysate at 40ug Lane 4: SW620 Whole Cell Lysate at 40ug Lane 5: JURKAT Whole Cell Lysate at 40ug Predicted band size: 45KD Observed band size: 45KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-PIM1, CT Antibody

The Rabbit Anti-PIM1, CT Antibody from United States Biological is a Rabbit Polyclonal antibody to PIM1. This antibody recognizes Homo Sapiens, and Human antigen. The Rabbit Anti-PIM1, CT Antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemRabbit Anti-PIM1, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303531
ClonalityPolyclonal
NCBI Gene AliasesPIM
NCBI Full Gene NamePim-1 proto-oncogene, serine/threonine kinase
ApplicationsWestern Blot (WB)
ReactivityHuman (Hu)
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
TargetPIM1, CT
ImmunogenSynthetic peptide corresponding to aa373-404, EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK, from human PIM1 at C-terminus, different from the related mouse sequence by 7aa and from the related rat sequence by 2aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!