Pab Rb x human STXBP2 (Syntaxin-Binding Protein 2, Munc18-2, STXB2, STXBP2, Unc18-2, UNC18B, Unc-18B) antibody 353298 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human STXBP2 (Syntaxin-Binding Protein 2, Munc18-2, STXB2, STXBP2, Unc18-2, UNC18B, Unc-18B) antibody

Western blotting All lanes: STXBP2 at 0.5ug/ml Lane 1: Rat Brain Tissue Lysate at 50ug Lane 2: Mouse Brain Tissue Lysate at 50ug Lane 3: HEPG2 Whole Cell Lysate at 40ug Lane 4: HELA Whole Cell Lysate at 40ug Predicted bind size: 66KD Observed bind size: 66KD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human STXBP2 (Syntaxin-Binding Protein 2, Munc18-2, STXB2, STXBP2, Unc18-2, UNC18B, Unc-18B) antibody

The Pab Rb x human STXBP2 (Syntaxin-Binding Protein 2, Munc18-2, STXB2, STXBP2, Unc18-2, UNC18B, Unc-18B) antibody from United States Biological is a Rabbit Polyclonal antibody to STXBP2. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human STXBP2 (Syntaxin-Binding Protein 2, Munc18-2, STXB2, STXBP2, Unc18-2, UNC18B, Unc-18B) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human STXBP2 (Syntaxin-Binding Protein 2, Munc18-2, STXB2, STXBP2, Unc18-2, UNC18B, Unc-18B) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number353298
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa184-215, QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD, of human STXBP2 at N-terminal, different from the related mouse and rat sequences by 1aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namesyntaxin binding protein 2
NCBI Gene AliasesFHL5, Hunc18b, MUNC18-2, UNC18-2, UNC18B, pp10122, unc-18B
ClonalityPolyclonal
TargetSTXBP2

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!