Rabbit Anti-CPT1B, NT Antibody 303250 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-CPT1B, NT Antibody

Anti-CPT1B antibody, Western blotting All lanes: Anti CPT1B at 0.5ug/ml Lane 1: Rat Skeletal Muscle Tissue Lysate at 50ug Lane 2: Rat Cardiac Muscle Tissue Lysate at 50ug Lane 3: Mouse Skeletal Muscle Tissue Lysate at 50ug Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50ug Lane 5: HELA Whole Cell Lysate at 40ug Predicted band size: 88KD Observed band size: 88KD
Rabbit Anti-CPT1B, NT Antibody

IHC(P): Mouse Skeletal Muscle Tissue
Rabbit Anti-CPT1B, NT Antibody

IHC(P): Rat Cardiac Muscle Tissue

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-CPT1B, NT Antibody

United States Biological's Rabbit Anti-CPT1B, NT Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The Rabbit Anti-CPT1B, NT Antibody was generated using CPT1B as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemRabbit Anti-CPT1B, NT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303250
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to aa197-226, DDEEYYRMELLAKEFQDKTAPRLQKYLVLK, from human CPT1B at N-terminus, different from the related mouse sequence by 2aa, and from the related rat sequence by 4aa
TargetCPT1B, NT
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namecarnitine palmitoyltransferase 1B
NCBI Gene AliasesCPT1-M, CPT1M, CPTI, CPTI-M, M-CPT1, MCCPT1, MCPT1
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!