Pab Rb x human TGFBR1, NT (TGF-beta Receptor Type-1) antibody 371047 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human TGFBR1, NT (TGF-beta Receptor Type-1) antibody

Western blot analysis of TGFBR1 expression in rat cardiac muscle extract (lane 1), mouse liver extract (lane 2) and HELA whole cell lysates (lane 3). TGFBR1 at 56KD was detected using TGFBR1 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human TGFBR1, NT (TGF-beta Receptor Type-1) antibody

The Pab Rb x human TGFBR1, NT (TGF-beta Receptor Type-1) antibody from United States Biological is a Rabbit Polyclonal antibody to TGFBR1. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human TGFBR1, NT (TGF-beta Receptor Type-1) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human TGFBR1, NT (TGF-beta Receptor Type-1) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371047
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human TGFBR1 (aa149-186, HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences. Species Sequence Homology: bovine, chicken, equine, monkey, rabbit
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nametransforming growth factor beta receptor 1
NCBI Gene AliasesESS1, ALK5, LDS2A, AAT5, MSSE, tbetaR-I, LDS1, ALK-5, ACVRLK4, TGFR-1, TBR-i, TBRI, SKR4, LDS1A
ClonalityPolyclonal
TargetTGFBR1, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!