Rabbit Anti-Heparanase 1 Antibody 303352 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-Heparanase 1 Antibody

Anti- Heparanase 1 antibody, Western blotting All lanes: Anti Heparanase 1 at 0.5ug/ml Lane 1: Rat Liver Tissue Lysate at 50ug Lane 2: Human Placenta Tissue Lysate at 50ug Lane 3: A549 Whole Cell Lysate at 40ug Predicted band size: 61KD Observed band size: 61KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-Heparanase 1 Antibody

United States Biological's Rabbit Anti-Heparanase 1 Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-Heparanase 1 Antibody was generated using heparanase, and HPSE as the antigen and it reacts with Homo Sapiens, Human, and Rat.

Product Specs
ItemRabbit Anti-Heparanase 1 Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303352
Quantity100ug
ApplicationsWB
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
Concentration~0.5mg/ml (after reconstitution)
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
Antibody TypePrimary
ReactivityHu, Rt
ImmunogenSynthetic peptide corresponding to aa301-331, NGRTATKEDFLNPDVLDIFISSVQKVFQVVE, from the middle region of human Heparanase 1, different from the related mouse and rat sequences by 8aa
TargetHeparanase 1
Hostrabbit
NCBI Full Gene Nameheparanase
NCBI Gene AliasesHPA, HPA1, HPR1, HPSE1, HSE1
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!