Pab Rb x human SLC18A3, NT (VAChT, Vesicular Acetylcholine Transporter) antibody 371040 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human SLC18A3, NT (VAChT, Vesicular Acetylcholine Transporter) antibody

Western blot analysis of SLC18A3 expression in HELA whole cell lysates (lane 1) and HEPA whole cell lysates (lane 2). SLC18A3 at 55KD was detected using SLC18A3 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human SLC18A3, NT (VAChT, Vesicular Acetylcholine Transporter) antibody

The Pab Rb x human SLC18A3, NT (VAChT, Vesicular Acetylcholine Transporter) antibody from United States Biological is a Rabbit Polyclonal antibody to SLC18A3. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The Pab Rb x human SLC18A3, NT (VAChT, Vesicular Acetylcholine Transporter) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human SLC18A3, NT (VAChT, Vesicular Acetylcholine Transporter) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371040
Antibody TypePrimary
ReactivityHu, Mo
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human SLC18A3 (aa1-36, MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by 5aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namesolute carrier family 18 member A3
NCBI Gene AliasesCMS21, VACHT
ClonalityPolyclonal
TargetSLC18A3, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!