Pab Rb x human ACSL5 antibody 377207 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human ACSL5 antibody

Western blot analysis of ACSL5 expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ACSL5 at 76KD was detected using ACSL5 at 0.5ug/ml. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human ACSL5 antibody

The Pab Rb x human ACSL5 antibody from United States Biological is a Rabbit Polyclonal antibody to ACSL5. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human ACSL5 antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human ACSL5 antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number377207
TargetACSL5
ClonalityPolyclonal
NCBI Gene AliasesACS5, FACL5, DIAR13, ACS2
NCBI Full Gene Nameacyl-CoA synthetase long chain family member 5
ApplicationsWestern Blot (WB)
ReactivityHu, Ms, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to aa337-378, ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA from human ACSL5, different from the related mouse and rat sequences by 6aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!