Pab Rb x human AOC1, NT (Amiloride-sensitive Amine Oxidase [Copper-containing]) antibody 370910 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human AOC1, NT (Amiloride-sensitive Amine Oxidase [Copper-containing]) antibody

Western blot analysis of ABP1 expression in NRK whole cell lysates (lane 1), 293T whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). ABP1 at 85KD was detected using ABP1 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human AOC1, NT (Amiloride-sensitive Amine Oxidase [Copper-containing]) antibody

United States Biological's Pab Rb x human AOC1, NT (Amiloride-sensitive Amine Oxidase [Copper-containing]) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human AOC1, NT (Amiloride-sensitive Amine Oxidase [Copper-containing]) antibody was generated using amine oxidase copper containing 1, and AOC1 as the antigen and it reacts with Homo Sapiens, Human, and Rat.

Product Specs
ItemPab Rb x human AOC1, NT (Amiloride-sensitive Amine Oxidase [Copper-containing]) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370910
ClonalityPolyclonal
TargetAOC1, NT
NCBI Gene AliasesABP, KAO, DAO, ABP1, DAO1
NCBI Full Gene Nameamine oxidase copper containing 1
ApplicationsWestern Blot (WB)
ReactivityHu, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human ABP1 (aa144-180, STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by 10aa, and from the related rat sequence by 8aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!