Pab Rb x human MMP13, NT (Matrix Metallopeptidase 13) antibody 371006 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human MMP13, NT (Matrix Metallopeptidase 13) antibody

Western blot analysis of MMP13 expression in HELA whole cell lysates (lane 1). MMP13 at 54KD was detected using MMP13 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human MMP13, NT (Matrix Metallopeptidase 13) antibody

United States Biological's Pab Rb x human MMP13, NT (Matrix Metallopeptidase 13) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human MMP13, NT (Matrix Metallopeptidase 13) antibody was generated using MMP13 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemPab Rb x human MMP13, NT (Matrix Metallopeptidase 13) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371006
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human MMP13 (aa109-154, RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by 4aa, and from the related rat sequence by 5aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namematrix metallopeptidase 13
NCBI Gene AliasesMMP-13, MANDP1, MDST, CLG3
ClonalityPolyclonal
TargetMMP13, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!