Pab Rb x human TNFRSF10A, NT (DR4, Tumor Necrosis Factor Receptor Superfamily Member 10A) antibody 371050 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human TNFRSF10A, NT (DR4, Tumor Necrosis Factor Receptor Superfamily Member 10A) antibody

Western blot analysis of DR4 expression in rat spleen extract (lane 1), mouse spleen extract (lane 2) and MCF-7 whole cell lysates (lane 3). DR4 at 50KD was detected using DR4 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human TNFRSF10A, NT (DR4, Tumor Necrosis Factor Receptor Superfamily Member 10A) antibody

The Pab Rb x human TNFRSF10A, NT (DR4, Tumor Necrosis Factor Receptor Superfamily Member 10A) antibody from United States Biological is a Rabbit Polyclonal antibody to TNFRSF10A. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human TNFRSF10A, NT (DR4, Tumor Necrosis Factor Receptor Superfamily Member 10A) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human TNFRSF10A, NT (DR4, Tumor Necrosis Factor Receptor Superfamily Member 10A) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number371050
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human TNFRSF10A (aa99-131, VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL)
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameTNF receptor superfamily member 10a
NCBI Gene AliasesTRAILR-1, TRAILR1, APO2, DR4, CD261
ClonalityPolyclonal
TargetTNFRSF10A, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!