Pab Rb x human GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody 370977 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody

Western blot analysis of GPI expression in human placenta extract (lane 1) and JURKAT whole cell lysates (lane 2). GPI at 63KD was detected using GPI at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody

The Pab Rb x human GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody from United States Biological is a Rabbit Polyclonal antibody to Glucose-6-phosphate isomerase, and GPI. This antibody recognizes Homo Sapiens, and Human antigen. The Pab Rb x human GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370977
ClonalityPolyclonal
TargetGPI, NT
NCBI Gene AliasesPHI, SA36, SA-36, GNPI, PGI, NLK, AMF
NCBI Full Gene Nameglucose-6-phosphate isomerase
ApplicationsWestern Blot (WB)
ReactivityHuman (Hu)
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human GPI (aa5-39, TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH), different from the related mouse and rat sequences by 16aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!