Pab Rb x human HNF1 beta, CT (HNF1 homeobox B, Hepatocyte nuclear factor 1-beta) antibody 350658 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human HNF1 beta, CT (HNF1 homeobox B, Hepatocyte nuclear factor 1-beta) antibody

HNF1 beta, Western blotting All lanes: HNF1 beta at 0.5ug/ml Lane 1: Rat Liver Tissue Lysate at 50ug Lane 2: Rat Kidney Tissue Lysate at 50ug Lane 3: SW620 Whole Cell Lysate at 40ug Predicted bind size: 61kD Observed bind size: 61kD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human HNF1 beta, CT (HNF1 homeobox B, Hepatocyte nuclear factor 1-beta) antibody

The Pab Rb x human HNF1 beta, CT (HNF1 homeobox B, Hepatocyte nuclear factor 1-beta) antibody from United States Biological is a Rabbit Polyclonal antibody to HNF1B. This antibody recognizes Homo Sapiens, Human, and Rat antigen. The Pab Rb x human HNF1 beta, CT (HNF1 homeobox B, Hepatocyte nuclear factor 1-beta) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human HNF1 beta, CT (HNF1 homeobox B, Hepatocyte nuclear factor 1-beta) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number350658
ClonalityPolyclonal
TargetHNF1 beta, CT
NCBI Gene AliasesADTKD3, FJHN, HNF-1-beta, HNF-1B, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, RCAD, T2D, TCF-2, TCF2, VHNF1
NCBI Full Gene NameHNF1 homeobox B
ApplicationsWestern Blot (WB)
ReactivityHu, Rt
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
ImmunogenSynthetic peptide corresponding to aa496-525, AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT, of human HNF1 beta at C-terminal
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!