Pab Rb x human TIM 1, CT (Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, KIM1, Kidney Injury Molecule 1) antibody 350846 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human TIM 1, CT (Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, KIM1, Kidney Injury Molecule 1) antibody

Anti-TIM1 antibody, Western blotting All lanes: Anti TIM1 at 0.5ug/ml Lane 1: HELA Whole Cell Lysate at 40ug Lane 2: PANC Whole Cell Lysate at 40ug Lane 3: HEPG2 Whole Cell Lysate at 40ug Lane 4: A549 Whole Cell Lysate at 40ug Predicted bind size: 49kD Observed bind size: 49kD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human TIM 1, CT (Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, KIM1, Kidney Injury Molecule 1) antibody

United States Biological's Pab Rb x human TIM 1, CT (Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, KIM1, Kidney Injury Molecule 1) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Pab Rb x human TIM 1, CT (Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, KIM1, Kidney Injury Molecule 1) antibody was generated using HAVCR1 as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemPab Rb x human TIM 1, CT (Hepatitis A virus cellular receptor 1 homolog, HAVcr-1, KIM1, Kidney Injury Molecule 1) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number350846
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa321-359, QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIEN- SLYATD, of human TIM 1 at C-terminal
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namehepatitis A virus cellular receptor 1
NCBI Gene AliasesCD365, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1
ClonalityPolyclonal
TargetTIM 1, CT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!