Rabbit Anti-SOD2, CT Antibody 303629 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-SOD2, CT Antibody

Anti-SOD2 antibody, Western blotting All lanes: Anti SOD2 at 0.5ug/ml Lane 1: Mouse Testis Tissue Lysate at 50ug Lane 2: Mouse Lung Tissue Lysate at 50ug Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug Lane 4: Mouse Liver Tissue Lysate at 50ug Lane 5: HEPG2 Whole Cell Lysate at 40ug Predicted band size: 25KD Observed band size: 25KD
Rabbit Anti-SOD2, CT Antibody

IHC(P): Human Mammary Cancer Tissue

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-SOD2, CT Antibody

The Rabbit Anti-SOD2, CT Antibody from United States Biological is a Rabbit Polyclonal antibody to SOD2. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The Rabbit Anti-SOD2, CT Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemRabbit Anti-SOD2, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303629
ClonalityPolyclonal
NCBI Gene AliasesGC1, GClnc1, IPO-B, IPOB, MNSOD, MVCD6, Mn-SOD
NCBI Full Gene Namesuperoxide dismutase 2
ApplicationsWB, IHC
ReactivityHu, Ms
Conjugate/TagUnconjugated
PurityPurified by immunoaffinity chromatography
Quantity100ug
Concentration~0.5mg/ml (after reconstitution)
Hostrabbit
TargetSOD2, CT
ImmunogenSynthetic peptide corresponding to aa192-222, QYKNVRPDYLKAIWNVINWENVTERYMACKK, from human SOD2 at C-terminus, different from the related mouse sequence by 1aa, and from the related rat sequence by 4aa
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
Antibody TypePrimary

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!