Pab Rb x human AGO2, NT (eIF2C2, Protein Argonaute-2) antibody 370894 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human AGO2, NT (eIF2C2, Protein Argonaute-2) antibody

Western blot analysis of Ago2/eIF2C2 expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Ago2/eIF2C2 at 97KD was detected using Ago2/eIF2C2 at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human AGO2, NT (eIF2C2, Protein Argonaute-2) antibody

The Pab Rb x human AGO2, NT (eIF2C2, Protein Argonaute-2) antibody from United States Biological is a Rabbit Polyclonal antibody to AGO2. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Pab Rb x human AGO2, NT (eIF2C2, Protein Argonaute-2) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human AGO2, NT (eIF2C2, Protein Argonaute-2) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370894
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of human Ago2 (aa129-169, KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences. Species Sequence Homology: bovine, canine, hamster, equine, monkey, rabbit
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameargonaute RISC catalytic component 2
NCBI Gene AliasesPPD, EIF2C2, LESKRES, CASC7, Q10, LINC00980
ClonalityPolyclonal
TargetAGO2, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!