Pab Rb x human GRK6, CT (GPRK6, G Protein-coupled Receptor Kinase 6) antibody 350645 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human GRK6, CT (GPRK6, G Protein-coupled Receptor Kinase 6) antibody

All lanes: GRK6 at 0.5ug/ml Lane 1: Rat Lung Tissue Lysate at 50ug Lane 2: HELA Whole Cell Lysate at 40ug Lane 3: K562 Whole Cell Lysate at 40ug Lane 4: JURKAT Whole Cell Lysate at 40ug Predicted bind size: 66kD Observed bind size: 66kD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human GRK6, CT (GPRK6, G Protein-coupled Receptor Kinase 6) antibody

United States Biological's Pab Rb x human GRK6, CT (GPRK6, G Protein-coupled Receptor Kinase 6) antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Product Specs
ItemPab Rb x human GRK6, CT (GPRK6, G Protein-coupled Receptor Kinase 6) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number350645
Antibody TypePrimary
ReactivityHu, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa382-417, QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR, of human GRK6 at C-terminal
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameG protein-coupled receptor kinase 6
NCBI Gene AliasesGPRK6
ClonalityPolyclonal
TargetGRK6, CT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!