Rabbit Anti-Human CFHR4 Polyclonal Antibody CTA-398 from Creative Biolabs | Biocompare.com

Be the first to write a review!

Supplier Page from
Creative Biolabs for
Rabbit Anti-Human CFHR4 Polyclonal Antibody

The Rabbit Anti-Human CFHR4 Polyclonal Antibody from Creative Biolabs is a Rabbit Polyclonal antibody to CFHR4. This antibody recognizes Human antigen. The Rabbit Anti-Human CFHR4 Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemRabbit Anti-Human CFHR4 Polyclonal Antibody
CompanyCreative Biolabs
Price Supplier Page View Company Product Page
Catalog NumberCTA-398
ClonalityPolyclonal
ReactivityHuman
ApplicationsWB
IsotypeIgG
ImmunogenThe immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK
TargetCFHR4
HostRabbit
Concentration1 mg/mL
NCBI Full Gene Namecomplement factor H related 4
NCBI Gene AliasesCFHL4, FHR-4, FHR4
FormatLiquid
Antibody TypePrimary Antibody
Purity≥95% as determined by SDS-PAGE
Quantity20; 100 µL
Research AreaHemolytic Uremic Syndrome, Atypical 1 and Hemolytic-Uremic Syndrome

Add to Compare List

Creative Biolabs

Creative Biolabs

Phone: 1-631-357-2254
1-631-416-1478

Email: info@creative-biolabs.com

Company Profile

Website: https://www.creativebiolabs.net/

Website: https://www.creative-biolabs.com/

Be the First to Write a Review!