Ataxin 1 (ATXN1) Rabbit Polyclonal Antibody TA360842 from OriGene Technologies | Biocompare.com

Supplier Images

Ataxin 1 (ATXN1) Rabbit Polyclonal Antibody

Host: Rabbit
Target Name: ATXN1
Sample Tissue: Human DLD1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Ataxin 1 (ATXN1) Rabbit Polyclonal Antibody

OriGene Technologies' Ataxin 1 (ATXN1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Ataxin 1 (ATXN1) Rabbit Polyclonal Antibody was generated using Ataxin 1, and ATXN1 as the antigen and it reacts with Homo Sapiens, and Human.

Description

ATXN1 Antibody - N-terminal region

Product Specs
ItemAtaxin 1 (ATXN1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA360842
Quantity100 µl
ApplicationsWB
ReactivityHuman
TargetAtaxin 1
HostRabbit
Antibody TypePrimary Antibodies
NCBI Full Gene Nameataxin 1
NCBI Gene AliasesD6S504E, SCA1, ATX1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugate/TagUnconjugated
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATXN1. The synthetic peptide is located within the following region: TAWLPGNPGGRGHGGGRHGPAGTSVELGLQQGIGLHKALSTGLDYSPPSA
Concentrationlot specific
PurityAffinity purified

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!