C17orf97 Rabbit Polyclonal Antibody TA357165 from OriGene Technologies | Biocompare.com

Supplier Images

C17orf97 Rabbit Polyclonal Antibody

Host: Rabbit
Target Name: C17ORF97
Sample Tissue: Human Liver Tumor
Antibody Dilution: 1ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C17orf97 Rabbit Polyclonal Antibody

The C17orf97 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen.

Description

C17orf97 Antibody

Product Specs
ItemC17orf97 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA357165
Quantity100 µl
ReactivityHuman
TargetC17orf97
HostRabbit
Antibody TypePrimary Antibodies
NCBI Full Gene Nameligand of ATE1
NCBI Gene AliasesCK20, C17orf97
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
Conjugate/TagUnconjugated
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
Concentrationlot specific
PurityAffinity Purified

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!