AGO2 Antibody PA5-78738 from Thermo Fisher Scientific | Biocompare.com

Supplier Images

AGO2 Antibody

AGO2 Antibody

Be the first to write a review!

Supplier Page from
Thermo Fisher Scientific for
AGO2 Antibody

The AGO2 Antibody from Thermo Fisher Scientific is a Rabbit Polyclonal antibody to AGO2. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The AGO2 Antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemAGO2 Antibody
CompanyThermo Fisher Scientific
Price Supplier Page
Catalog NumberPA5-78738
Quantity100 µg
ApplicationsWestern Blot
Concentration500 µg/mL
Conjugate/TagUnconjugated
FormatPBS with 4mg trehalose and no preservative
PurityAntigen affinity chromatography
ReactivityHuman, Mouse, Rat
TargetAGO2
IsotypeIgG
HostRabbit
Antibody TypePrimary
Storage Temperature-20°C
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL)
NCBI Full Gene Nameargonaute RISC catalytic subunit 2, argonaute RISC catalytic component 2
NCBI Gene AliasesGerp95, eIF2C 2, PPD, 2310051F07Rik, Gm10365, Eif2c2, LESKRES, CASC7, Q10, mKIAA4215, LINC00980, EIF2C2, 1110029L17Rik
ClonalityPolyclonal
Storage-20°C

Add to Compare List

Thermo Fisher Scientific

Thermo Fisher Scientific

Thermo Fisher Scientific

81 Wyman Street

Waltham, MA 02451

United States

Phone: 800-678-5599
Fax: 800-331-2286

Company Profile

Website: www.thermofisher.com

Be the First to Write a Review!