Description
Enzyme Immunoassay for the estimation of Human Vascular Endothelial Cell Growth Factor (VEGF) ELISA in serum and plasma, tissue homogenates and other biological fluids. Epidermal growth factor (EGF) is a protein that stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is 6-kDa[5] and has 53 amino acid residues and three intramolecular disulfide bonds. EGF was originally described as a secreted peptide found in the submaxillary glands of mice and in human urine. EGF has since been found in many human tissues, including platelets,submandibular gland (submaxillary gland), and parotid gland.Initially, human EGF was known as urogastrone.In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR),with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).EGF, via binding to its cognate receptor, results in cellular proliferation, differentiation, and survival.Salivary EGF, which seems to be regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents ELISA Features include: Ready to use protocol, Standardisation and High Reproducibility with Lot to Lot Consistency, Validation against a seven point system for a Gold Ring Standard Quality ELISA - the benchmark for Krishgen quality. The GENLISA ELISA kits are used for assessing the specific biomarker in samples analytes which may be serum, plasma, biological fluids and cell culture supernatant