Picro-Sirius Red Stain Kit (Cardiac Muscle) ab245887 from Abcam

Product Specs
ItemPicro-Sirius Red Stain Kit (Cardiac Muscle)
CompanyAbcam
Price Supplier Page View Company Product Page
Catalog Numberab245887
TypeStain
Quantity1 Kit

Add to Compare List

Abcam

Discovery Drive

Cambridge Biomedical Campus

Cambridge CB2 0AX

United Kingdom

Phone: +44 (0) 1223 696000 (option 1)
+44 (0) 1223 696000 (option 2)
+44 (0) 1223 771600

Company Profile

Website: http://www.abcam.com

(1) Injured cardiac targeting magnetic nanovesicles for mRNA treatment of myocardial infarctionTheranosticsJanuary 21, 2026Dasom Mun, Ji-Young Kang, Malgeum Park, Gyeongseo Yoo, Jaewoong Lee, Nuri Yun, Boyoung Joungassess fibrotic remodeling in infarcted myocardium, both Masson's trichrome and Sirius Red staining (ab245887, Abcam, Waltham, MA, USA) were performed. In Masson's trichrome staining, collagen-rich fibrotic regions

(2) Suppression of CSF2RA macrophage polarisation impacts pathological cardiac remodelling in miceScientific ReportsJanuary 9, 2026Georgios Kremastiotis, Yong Li, Andrew Bond, Daire Shanahan, Karina Di Gregoli, Alastair W. Poole, Sarah J. George, Jason L. Johnsonfibre content was assessed using a Picrosirius Red stain kit for cardiac muscle (catalogue number, ab245887, Abcam), according to the manufacturer’s instructions; images were analysed under linearly polarised

(3) β-Caryophyllene Ameliorates Thioacetamide-Induced Liver Fibrosis in Rats: A Preventative ApproachInternational Journal of Molecular SciencesSeptember 1, 2025Lujain Bader Eddin, Amar Mahgoub, Saeeda Almarzooqi, Ernest Adeghate, Sandeep B. Subramanya, Shreesh Ojha(Olympus, Hamburg, Germany). Masson’s Trichrome (ab150686; Abcam, Cambridge, UK) and Picrosirius red (ab245887; Abcam, Cambridge, UK) staining was also performed using purchased kits. 4.14. Immunohistochemical Staining

(4) Dietary influences on chemotherapy sensitivity and cardiotoxicity modulated by IRE1 targeting in triple-negative breast cancer in female micePhysiological reportsSeptember 1, 2025Feliz-Mosquea YR, Wilson AS, Cruz-Diaz N, Payne VS, Cook KL, Soto-Pantoja DR.tissue was stained for fibrosis using a Picrosirius red pan‐collagen staining protocol (Abcam, Cat #ab245887). Also, cardiac sections were stained against IRE1α antibody (Novus Cat#, NB100‐2323; 1:500), cleaved

(5) Reduction in myofilament Ca2+ sensitivity partially ameliorates the cardiac phenotype in hypertrophic cardiomyopathy linked to a TnT-R92Q mutationFront PhysiolMay 23, 2025Paulina Langa, Angelie Bacon, Chad M. Warren, Shamim A. K. Chowdhury, Monika Halas, Aurelia A. Fernandes, Mark D. McCauley, Paul H. Goldspink, R. John Solaro, Beata M. Wolskaassess fibrosis, sections were stained with a Picro Sirius Staining kit for cardiac muscle (Abcam, cat. ab245887) to visualize collagenous fibrotic tissue. Pixels corresponding to the area stained red, indicating

(6) Melanocortin 1 Receptor Regulates Pathological and Physiological Cardiac RemodelingJournal of the American Heart AssociationFebruary 18, 2025Anni Suominen, Aino Suni, Saku Ruohonen, Zoltán Szabó, Lotta Pohjolainen, Minying Cai, Eriika Savontaus, Virpi Talman, Risto Kerkelä, Petteri Rinneserial sections. Sections were stained with hematoxylin and eosin and Picro‐Sirius red (Abcam, No. ab245887) to measure the cross‐sectional area (CSA) of cardiomyocytes, cardiomyocyte length, and cardiac fibrosis

(7) Single-cell transcriptomics reveal distinctive patterns of fibroblast activation in heart failure with preserved ejection fractionBasic research in cardiologyDecember 1, 2024Lanzer JD, Wienecke LM, Ramirez Flores RO, Zylla MM, Kley C, Hartmann N, Sicklinger F, Schultz JH, Frey N, Saez-Rodriguez J, et al.sectioned (5 μm). Cardiac fibrosis was assessed using the cardiac muscle Picrosirius-Red Stain Kit (Abcam, ab245887) according to the manufacturer's instructions. Quantification was performed on total heart scans by

(8) SUMOylation of TP53INP1 is involved in miR-30a-5p-regulated heart senescenceExperimental & Molecular MedicineNovember 7, 2024Yi-Xiang Hong, Chan Wu, Jing-Zhou Li, Fei Song, Yu Hu, Yue Han, Yi-Jie Mao, Wei-Yin Wu, Yan Wang, Gang LiL4895) was purchased from Sigma‒Aldrich (St. Louis, MO, USA). The Picrosirius Red Staining Kit (Cat# Ab245887) was purchased from Abcam (Cambridge, UK). Human SUMO1 (MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV),

(9) Investigating the cause of cardiovascular dysfunction in chronic kidney disease: capillary rarefaction and inflammation may contribute to detrimental cardiovascular outcomesBasic Research in CardiologyOctober 30, 2024Siavash Beikoghli Kalkhoran, Maryna Basalay, Zhenhe He, Pelin Golforoush, Tayeba Roper, Ben Caplin, Alan D. Salama, Sean M. Davidson, Derek M. Yellonthe heart. Picrosirius red staining was conducted according to the manufacturer’s instructions (Abcam-AB245887). Vascular calcification was assessed by Von Kossa staining [5]. Renal sections were stained with Periodic

(10) SPTLC3 Is Essential for Complex I Activity and Contributes to Ischemic CardiomyopathyCirculationAugust 20, 2024Anna Kovilakath, Adolfo G. Mauro, Yolander A. Valentine, Frank J. Raucci, Maryam Jamil, Christiane Carter, Jeremy Thompson, Qun Chen, Gisela Beutner, Yang Yue, et al.LSM 700). The list of primary antibodies used can be found in Suppl. Table 2. PicroSirius red (Abcam, ab245887) and Fast FCF Green (Millipore Sigma, 68724) staining was employed for assessment of fibrotic scar formation

(11) Exploring the Potential of Saphenous Vein Grafts Ex Vivo: A Model for Intimal Hyperplasia and Re-EndothelializationJournal of Clinical MedicineAugust 14, 2024Nur A’tiqah Haron, Mohamad Fikeri Ishak, Muhammad Dain Yazid, Ubashini Vijakumaran, Roszita Ibrahim, Raja Zahratul Azma Raja Sabudin, Hafiza Alauddin, Nur Ayub Md Ali, Hairulfaizi Haron, Muhammad Ishamuddin Ismail, et al.slides were stained with H&E as previously described [28]. Additionally, slides for Picro-Sirius Red (ab245887, Abcam, Fremont, CA, USA), Elastin Van Gieson (ab150667, Abcam, Fremont, CA, USA), and Alcian Blue (ab150662,

(12) Pyroptosis and mitochondrial function participated in miR-654-3p-protected against myocardial infarctionCell Death & DiseaseJune 4, 2024Chan Wu, Xiao-Cheng Zhang, Lan-Ruo Chen, Hui-Zhu Huang, Wei-Yin Wu, Yan Wang, Gang Liand Eosin (H&E) staining was performed for histological examination. Sirius red staining kit (Cat#: ab245887; Abcam) was used to identify collagen fibers. For H&E staining, sections were fixed using 4% paraformaldehyde.

(13) Loss of Bone Morphogenetic Protein-9 Reduces Survival and Increases MMP Activity After Myocardial InfarctionJACC. Basic to translational scienceOctober 1, 2023Bhave S, Esposito M, Swain L, Qiao X, Martin G, Wadhwa S, Everett K, Kapur NK.95% ethanol, 70% ethanol, and 50% ethanol; and finally into Milli Q water. Picrosirius red staining (ab245887; Abcam) was performed using the manufacturer’s protocol. Cell culture The Tufts Medical Center Institutional

(14) Radiation nephropathy: Mechanisms of injury and recovery in a murine modelRadiotherapy and OncologyOctober 1, 2023Anis Ahmad, Junwei Shi, Saba Ansari, Sandra Merscher, Alan Pollack, Youssef Zeidan, Alessia Fornoni, Brian Marplesusing a standard protocol by the University of Miami histology core. Picrosirius red (PSR Kit, Abcam #ab245887) and Masson’s trichrome (Trichrome Stain Kit Abcam #ab150686) staining of paraffin-embedded kidney sections

(15) STEMIN and YAP5SA synthetic modified mRNAs regenerate and repair infarcted mouse heartsJ Cardiovasc AgingJuly 1, 2022Xiao S, Liang R, Lucero E, McConnell BK, Chen Z, Chang J, Navran S, Schwartz RJ, Iyer D.set at 10 μm to section the tissue. Histology and immunofluorescence Picrosirius red (Abcam; Cat# ab245887) and immunofluorescence staining were performed by standard methods using 8 μm paraffin sections. Antibodies

(16) Direct Detection of Pulmonary Fibrosis by Near-Infrared-Responsive Biomimetic PlateletsInternational Journal of NanomedicineJanuary 10, 2022Guanlie Li et al.Picro-Sirius red kits, according to the manufacturer’s instructions respectively (ab245880, ab150686, ab245887, Abcam, Cambridge, UK). Fibrotic tissue was quantified as the percentage of fibrotic area to the total

(17) Natural Heart Regeneration in a Neonatal Rat Myocardial Infarction ModelCellsJanuary 16, 2020Hanjay Wang et al.8310-16). For staining with picrosirius red (Picro-Sirius Red Stain Kit-Cardiac Muscle, Abcam, Cat: ab245887, Cambridge, MA, USA), the tissue was thawed at 4 °C for 10 min, then soaked in Xylene twice for a total

Be the First to Write a Review!

Picro-Sirius Red Stain Kit (Cardiac Muscle) from Abcam

Abcam

Citations (17)

Reviews

Picro-Sirius Red Stain Kit (Cardiac Muscle) from Abcam

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map