OXA1L Rabbit Polyclonal Antibody from OriGene Technologies | Biocompare.com

Supplier Images

OXA1L Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: OXA1L; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml; OXA1L is supported by BioGPS gene expression data to be expressed in HepG2

Be the first to write a review!

Supplier Page from
OriGene Technologies for
OXA1L Rabbit Polyclonal Antibody

OriGene Technologies' OXA1L Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The OXA1L Rabbit Polyclonal Antibody was generated using OXA1L mitochondrial inner membrane protein as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-OXA1L Antibody

Product Specs
ItemOXA1L Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339438
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/Tag/LabelUnconjugated
PurityProtein A purified
ReactivityHuman
TargetOXA1L
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-OXA1L antibody is: synthetic peptide directed towards the C-terminal region of Human OXA1L. Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
Validated ApplicationsWestern Blot (WB)
NCBI Full Gene NameOXA1L mitochondrial inner membrane protein
NCBI Gene AliasesOXA1L1, OXA1
ClonalityPolyclonal
Validated Species ReactivityHuman (Hu)
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!