Aviptadil (VIP, Vasoactive Intestinal Peptide) from United States Biological | Biocompare.com

Supplier Images

Aviptadil (VIP, Vasoactive Intestinal Peptide)

Aviptadil; HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2; Vasoactive Intestinal Peptide; Vasoactive Intestinal Octacosapeptide; VIP (human, mouse, rat); RLF-100

Be the first to write a review!

Supplier Page from
United States Biological for
Aviptadil (VIP, Vasoactive Intestinal Peptide)

Product Specs
ItemAviptadil (VIP, Vasoactive Intestinal Peptide)
CompanyUnited States Biological
Price $253.00Supplier Page View Company Product Page
Catalog Number550801
FormatWhite to off-white powder
Quantity1mg
Purity≥98% (HPLC)
TargetAviptadil

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!