ReadiUse™ ABTS Substrate Solution *Optimized for ELISA Assays with HRP Conjugates* from AAT Bioquest, Inc.

Product Specs
ItemReadiUse™ ABTS Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*
CompanyAAT Bioquest, Inc.
Price $198.00Supplier Page View Company Product Page
Catalog Number11001
ApplicationsELISA
Quantity1 L
FormatOptimized for ELISA Assays with HRP Conjugates

Add to Compare List

AAT Bioquest, Inc.

520 Mercury Drive

Sunnyvale, CA 94085

United States

Phone: 1-800-990-8053 (US and Canada)
1-408-733-1055 (International)

Email: info@aatbio.com

Company Profile

Website: https://www.aatbio.com/

(1) A skin colonizer disrupts inflammatory and humoral immune defenses in hidradenitis suppurativaEMBO Molecular MedicineMarch 24, 2026Viviane A Agbogan, Florence Bugault, Laure Guenin-Macé, Inta Gribonika, Cyril Planchais, Jean-David Morel, Jérémie Delaleu, P Juliana Pérez-Chaparro, Michael Atlan, Maïa Delage, et al.concentration) and by adding 100 µL of HRP chromogenic substrate (ABTS solution, AAT Bioquest, Cat# 11001) after the PBST washing steps. Antibody references were HRP-goat anti-human IgG, Fcγ secondary antibody

(2) Broad sarbecovirus neutralization by combined memory B cell antibodies to ancestral SARS-CoV-2iScienceJuly 19, 2024Planchais C, Fernández I, Chalopin B, Bruel T, Rosenbaum P, Beretta M, Dimitrov JD, Conquet L, Donati F, Prot M, et al.streptavidin,BD Biosciences,#554066; RRID:AB_2868972 ReadiUse ABTS Substrate Solution,AAT Bioquest,#11001 Fusion peptide (FP; 5KRSFIEDLLFNKVTLADAGFIK),GenScript Biotech,N/A HR2 peptide (DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP),GenScript

Be the First to Write a Review!

ReadiUse™ ABTS Substrate Solution Optimized for ELISA Assays with HRP Conjugates from AAT Bioquest, Inc.

Description

AAT Bioquest, Inc.

Citations (2)

Reviews

ReadiUse™ ABTS Substrate Solution Optimized for ELISA Assays with HRP Conjugates from AAT Bioquest, Inc.

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map