ReadiUse™ ABTS Substrate Solution *Optimized for ELISA Assays with HRP Conjugates* from AAT Bioquest, Inc.

Product Specs
ItemReadiUse™ ABTS Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*
CompanyAAT Bioquest, Inc.
Price $82.00Supplier Page View Company Product Page
Catalog Number11013
ApplicationsELISA
Quantity100 mL
FormatOptimized for ELISA Assays with HRP Conjugates

Add to Compare List

AAT Bioquest, Inc.

520 Mercury Drive

Sunnyvale, CA 94085

United States

Phone: 1-800-990-8053 (US and Canada)
1-408-733-1055 (International)

Email: info@aatbio.com

Company Profile

Website: https://www.aatbio.com/

(1) A skin colonizer disrupts inflammatory and humoral immune defenses in hidradenitis suppurativaEMBO Molecular MedicineMarch 24, 2026Viviane A Agbogan, Florence Bugault, Laure Guenin-Macé, Inta Gribonika, Cyril Planchais, Jean-David Morel, Jérémie Delaleu, P Juliana Pérez-Chaparro, Michael Atlan, Maïa Delage, et al.concentration) and by adding 100 µL of HRP chromogenic substrate (ABTS solution, AAT Bioquest, Cat# 11001) after the PBST washing steps. Antibody references were HRP-goat anti-human IgG, Fcγ secondary antibody

(2) Broad sarbecovirus neutralization by combined memory B cell antibodies to ancestral SARS-CoV-2iScienceJuly 19, 2024Planchais C, Fernández I, Chalopin B, Bruel T, Rosenbaum P, Beretta M, Dimitrov JD, Conquet L, Donati F, Prot M, et al.streptavidin,BD Biosciences,#554066; RRID:AB_2868972 ReadiUse ABTS Substrate Solution,AAT Bioquest,#11001 Fusion peptide (FP; 5KRSFIEDLLFNKVTLADAGFIK),GenScript Biotech,N/A HR2 peptide (DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP),GenScript

Be the First to Write a Review!

ReadiUse™ ABTS Substrate Solution Optimized for ELISA Assays with HRP Conjugates from AAT Bioquest, Inc.

Description

AAT Bioquest, Inc.

Citations (2)

Reviews

ReadiUse™ ABTS Substrate Solution Optimized for ELISA Assays with HRP Conjugates from AAT Bioquest, Inc.

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map