CRF Human Rat peptide orb216549 from Biorbyt

Product Specs
ItemCRF Human Rat peptide
CompanyBiorbyt
Price $520.00Supplier Page
Catalog Numberorb216549
Size1 mg, 5 mg, 10 mg
FormatLyophilized powder
Purity> 95%
Molecular Weight4575.5
FormulaC208H344N60O63S2
StorageShipped at 4°C. Store at -20°C for one year

Specifications/Features

Application Notes: CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Sequence

H Ser Glu Glu Pro Pro Ile Ser Leu Asp Leu Thr Phe His Leu Leu Arg Glu Val Leu Glu Met Ala Arg Ala Glu Gln Leu Ala Gln Gln Ala His Ser Asn Arg Lys Leu Met Glu Ile Ile NH2

Add to Compare List