Mouse Interleukin 10 (IL10) Protein abx651519 from Abbexa Ltd

Product Specs
ItemMouse Interleukin 10 (IL10) Protein
CompanyAbbexa Ltd
Price $464.00Supplier Page View Company Product Page
Catalog Numberabx651519
Molecule NameInterleukin 10 (IL10)
FormatLyophilized, Prior to lyophilization: 10 mM PBS, pH 7.4, containing 0.01% Sarcosyl, 5% Trehalose
ApplicationsWB, SDS-PAGE
Source/Expression System293F cells
Molecular WeightCalculated MW: 20.4 kDa
Observed MW: 22 kDa
Conjugate/TagUnconjugated
Size50 µg, 100 µg, 200 µg, 500 µg, 1 mg
Purity> 97%
ConcentrationPrior to lyophilization: 200 µg/ml
SpeciesMouse
NCBI Full Gene Nameinterleukin 10
NCBI Gene AliasesCSIF, If2a, Il-10
StorageStore lyophilized form at 2-8°C for up to 1 month. For longer periods, store lyophilized or liquid at -80°C. Avoid repeated freeze–thaw cycles

Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Add to Compare List