EP4 Receptor (C-Term) Blocking Peptide from Cayman Chemical

Supplier Page

Supplier Page from
Cayman Chemical for
EP4 Receptor (C-Term) Blocking Peptide

Request Info

Description

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor