Bio-Rad (Formerly AbD Serotec)'s HuCAL Fab-dHLX-FSx2 NEGATIVE CONTROL antibody is a Human monoclonal antibody. This antibody has been shown to work in applications such as: EIA, Immunoassay, and ELISA.
Description
A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. This Fab fragment is dimerized via a helix-turn-helix motif. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid