- Jagged 2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86337
- PBS (pH 7.2) and 40% Glycerol
- HJ2, LGMDR27, SER2
- Jagged 2
- Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
- Rabbit
- Human, Mouse
- This antibody was developed against Recombinant Protein corresponding to amino acids: LVVIPFQFAW PRSFTLIVEA WDWDNDTTPN EELLIERVSH AGMINPEDRW KSLHFSGHVA HLELQIRVRC DENYYS
- Unconjugated
- 0.1 ml (also 25ul)
- jagged canonical Notch ligand 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Cycle and Replication, Stem Cell Signaling Pathway
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS
Specifications/Features
Available conjugates: Unconjugated