- SH3YL1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84133
- Human
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Unconjugated
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: FTYCKSRGLF AGVSLEGSCL IERKETNRKF YCQDIRAYDI LFGDTPRPAQ AEDLYEILDS FTEKYENEG
- RAY
- SH3YL1
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- SH3 and SYLF domain containing 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 37 kDa
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
Specifications/Features
Available conjugates: Unconjugated