- H1FOO Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86265
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- H1FOO
- This antibody was developed against Recombinant Protein corresponding to amino acids: YRKTKAESKS SKPTASKVKN GAASPTKKKV VAKAKAPKAG QGPNTKAAAP AKGSGSKVVP AHLSRKTEAP KGPRKAGLPI KASSSKVSSQ
- Human
- Rabbit
- H1.8, H1FOO, H1oo, osH1
- Unconjugated
- H1.8 linker histone
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Phospho Specific
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ
Specifications/Features
Available conjugates: Unconjugated