- Glycine N-Methyltransferase/GNMT Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89512
- This antibody was developed against Recombinant Protein corresponding to amino acids: EEANWMTLDK DVPQSAEGGF DAVICLGNSF AHLPDCKGDQ SEHRLALKNI ASMVRAGGLL VIDHRNY
- 0.1 ml (also 25ul)
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- Rabbit
- Glycine N-Methyltransferase/GNMT
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- glycine N-methyltransferase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- HEL-S-182mP
- Immunogen affinity purified
- Primary Antibodies
- Vision
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY
Specifications/Features
Available conjugates: Unconjugated