- Transketolase Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87441
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- HEL-S-48, HEL107, SDDHD, TK, TKT1
- Human, Mouse, Rat
- Transketolase
- This antibody was developed against Recombinant Protein corresponding to amino acids: IAKTFKGRGI TGVEDKESWH GKPLPKNMAE QIIQEIYSQI QSKKKILATP PQEDAPSVDI ANIRMPSLPS YKVGDKIATR KAYGQ
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated
- 0.1 ml (also 25ul)
- Unconjugated
- transketolase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
IAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQ
Specifications/Features
Available conjugates: Unconjugated