- FAM18B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88090
- FAM18B
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- CGI-148, FAM18B, FAM18B1, NPD008, YDR084C
- Human
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: RCKVRSRKHL TSMATSYFGK QFLRQNTGDD QTS
- trans-golgi network vesicle protein 23 homolog B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Immunogen affinity purified
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Primary Antibodies
- Polyclonal
Sequence
RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Specifications/Features
Available conjugates: Unconjugated