- SLC35B2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-80641
- HLD26, PAPST1, SLL, UGTrel4
- 0.1 ml (also 25ul)
- Unconjugated
- Rabbit
- SLC35B2
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: FRRKNYLETG RGLCFPLVKA CVFGNEPKAS DEVPLAPRTE AAETT
- PBS (pH 7.2) and 40% Glycerol
- solute carrier family 35 member B2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Specifications/Features
Available conjugates: Unconjugated