- Mucolipin 1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92152
- MG-2, ML1, ML4, MLIV, MST080, MSTP080, TRP-ML1, TRPM-L1, TRPML1
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: DTIKHPGGAG AEESELQAYI AQCQDSPTSG KFRRGSGSAC SLLCCCGRDP SE
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Mucolipin 1
- Human
- Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
- mucolipin TRP cation channel 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Biology, Neuroscience, Sensory Systems, Signal Transduction, Vision
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSE
Specifications/Features
Available conjugates: Unconjugated