- CEP85L Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90780
- Human
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- C6orf204, LIS10, NY-BR-15, bA57K17.2
- This antibody was developed against Recombinant Protein corresponding to amino acids: SKLRESLTPD GSKWSTSLMQ TLGNHSRGEQ DSSLDMKDFR PLRKWSSLSK LTAPDNCGQG GTVCREESRN GLEK
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- CEP85L
- centrosomal protein 85 like
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEK
Specifications/Features
Available conjugates: Unconjugated