- CD277/BTN3A1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90750
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: KREQELREMA WSTMKQEQST RVKLLEELRW RSIQYASRGE RHSAYNEWKK ALFKPADVIL DPKTANPILL
- CD277/BTN3A1
- Human
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- BT3.1, BTF5, BTN3.1, CD277
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- butyrophilin subfamily 3 member A1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
Specifications/Features
Available conjugates: Unconjugated