- TMED1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81595
- TMED1
- Human
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: PPIQDGEFTF LLPAGRKQCF YQSAPANASL ETEYQVIGGA GLDVDFTLES PQGVLLVSES RKADG
- Unconjugated
- IL1RL1LG, Il1rl1l, Tp24, p24g1
- Rabbit
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- transmembrane p24 trafficking protein 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG
Specifications/Features
Available conjugates: Unconjugated