- SMEK2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83882
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- FLFL2, PP4R3B, PSY2, SMEK2, smk1
- 0.1 ml
- Human, Mouse, Rat
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: GQTFKGLKTK YEQEKDRQNQ KLNSVPSILR SNRFRRDAKA LEEDEEMWFN EDEEEEGKAV MPPLE
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- SMEK2
- protein phosphatase 4 regulatory subunit 3B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
Specifications/Features
Available conjugates: Unconjugated